PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016500079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SRS
Protein Properties Length: 214aa    MW: 24181.8 Da    PI: 8.3913
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016500079.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702170.67.9e-5391453154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaes 96 
                     s +++CqdCGnqakkdC++ RCRtCC+srgf+C+th+kstW p++ rr r++ ++++s+ +++ +   + +kr r                ++++
  XP_016500079.1   9 SSSSRCQDCGNQAKKDCTYLRCRTCCRSRGFHCQTHIKSTWAPVSTRRPRHHLHQQLSTIQQQLQaVPNPNKRYR----------------ENHE 87 
                     56789********************************************97766665433322110122222222................2223 PP

          DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +  e  ++P evs +avfrc+rvss+d+  +++aYqt+v+igGhvfkGiLydqG e+
  XP_016500079.1  88 IQGEEEGDFPGEVSFPAVFRCIRVSSIDNVVDQYAYQTSVQIGGHVFKGILYDQGSEN 145
                     34556678***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.3E-5611144IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.9E-251455IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.5E-2596142IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MMKEVEGSSS SSRCQDCGNQ AKKDCTYLRC RTCCRSRGFH CQTHIKSTWA PVSTRRPRHH  60
LHQQLSTIQQ QLQAVPNPNK RYRENHEIQG EEEGDFPGEV SFPAVFRCIR VSSIDNVVDQ  120
YAYQTSVQIG GHVFKGILYD QGSENRYNNM AAGESSSFQQ QQPPNLLTAA TTSTTEAPSY  180
PNPFSTFIPG YHHMGANKTN QYLYGVHASF KFYG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016500079.11e-163PREDICTED: protein SHORT INTERNODES-like isoform X1
SwissprotQ9XGX02e-53SHI_ARATH; Protein SHORT INTERNODES
TrEMBLK4B3M74e-78K4B3M7_SOLLC; Uncharacterized protein
STRINGSolyc01g110140.2.11e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.17e-49Lateral root primordium (LRP) protein-related